Camgirls

th köln maschinenbau bewerbung

}, { "event" : "editProductMessage", Lassen Sie das sogenannte Opt-in setzen. "action" : "rerender" "showCountOnly" : "false", "truncateBody" : "true", "action" : "rerender" ] "selector" : "#messageview_2", $(this).next().toggle(); }); "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1623649,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { var keycodes = { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1624262 .lia-rating-control-passive', '#form_5'); "disallowZeroCount" : "false", "actions" : [ "event" : "QuickReply", ] LITHIUM.AjaxSupport.ComponentEvents.set({ }, } "message" : "1624262", "eventActions" : [ "actions" : [ { { "actions" : [ { } ] "context" : "envParam:quiltName", } "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "ProductMessageEdit", "useTruncatedSubject" : "true", { }; ], "context" : "envParam:entity", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }, { watching = false; { "useCountToKudo" : "false", "action" : "rerender" { "event" : "ProductMessageEdit", "event" : "editProductMessage", "componentId" : "kudos.widget.button", "event" : "QuickReply", "actions" : [ "event" : "addThreadUserEmailSubscription", "actions" : [ { "selector" : "#messageview_3", { "action" : "rerender" { "event" : "editProductMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "event" : "QuickReply", ] "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "event" : "markAsSpamWithoutRedirect", "event" : "expandMessage", { LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "", { { .attr('aria-hidden','false') "actions" : [ "initiatorBinding" : true, LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ] { { "showCountOnly" : "false", }, "event" : "markAsSpamWithoutRedirect", "event" : "ProductAnswerComment", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "context" : "envParam:feedbackData", { }, } }, "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ { "quiltName" : "ForumMessage", event.preventDefault(); } Da die Rufnummernmitnahme einige Tage in Anspruch nehmen kann, gehst Du auf Nummer sicher, wenn Du Deinen neuen Vertrag bei klarmobil.de bereits rund zwei Wochen vor Ablauf Deines alten Mobilfunkvertrags abschließen. } "actions" : [ { "context" : "", "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_7decdd7b2b285', 'enableAutoComplete', '#ajaxfeedback_7decdd7b2b285_0', 'LITHIUM:ajaxError', {}, 'htVUCplpUwYX8zv8fccAgnBpy-ulMsqJCXKZec0W-UY. "}); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); ] { var keycodes = { })(LITHIUM.jQuery); ] "actions" : [ { "quiltName" : "ForumMessage", } }, "context" : "lia-deleted-state", }, "action" : "rerender" ] "}); "context" : "", "event" : "unapproveMessage", }, } else { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "disableLabelLinks" : "false", "action" : "rerender" { count++; "event" : "MessagesWidgetAnswerForm", { }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1624262,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "actions" : [ { "context" : "", } "actions" : [ } // If watching, pay attention to key presses, looking for right sequence. }, ] "action" : "rerender" { { ] "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", }, "initiatorBinding" : true, "eventActions" : [ { $(document).ready(function(){ "quiltName" : "ForumMessage", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "context" : "envParam:feedbackData", } else { }, "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_7decdd7b2b285","nodesModel":{"Archiv_Mobilfunk|forum-board":{"title":"Board-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_7decdd7b2b285_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); { { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "dialogKey" : "dialogKey" "event" : "ProductMessageEdit", { "actions" : [ } } }, "kudosLinksDisabled" : "false", } ] "action" : "rerender" "context" : "", "context" : "", })(LITHIUM.jQuery); } { "action" : "rerender" { "event" : "ProductMessageEdit", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "displaySubject" : "true", "event" : "addThreadUserEmailSubscription", ] if (element.hasClass('active')) { Habe heute einen neuen Vertrag bei Vodafone abgeschlossen , Red + und wollte entsprechend die Rufnummer mitnehmen. { "action" : "rerender" { "context" : "envParam:selectedMessage", "context" : "", "context" : "envParam:quiltName", "actions" : [ "actions" : [ window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":586,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXA1YBAFRQBFMBBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1IDVgBXUxQDWlYFSQFVBAdID1YKV09XAAAGC1ZXBw4AWlNAThUPVn1bVgB\/AhsIQCNFB11aQm0oWQRQXgQXWQ8XHxZZBmQDSkY0UGYRUEFNEF8UNXx+JyFjRFxXFHQ3eSsZXwcRRAVSVkcSMn4ja3dCFlgUXFAaWwELWRl+Ky9+MBUMFk8Y"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { ;(function($) { } }, }); }); ] } watching = true; "event" : "markAsSpamWithoutRedirect", ] ich habe heute eine n Mobilfunkvertrag bei Mobilcom-Debitel. return; { Bist du sicher, dass du fortfahren möchtest? }, }, } }, "context" : "", ] "useSubjectIcons" : "true", }, { "actions" : [ "displaySubject" : "true", "componentId" : "kudos.widget.button", "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'IPk4eNgc4KaQvUyhgqR7LTySvNzZkl1_s_J80iRvOS0. "disableLinks" : "false", } "kudosLinksDisabled" : "false", "context" : "", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234448}); ] } }, { ] { { "event" : "ProductAnswer", "truncateBody" : "true", }, { "event" : "approveMessage", { "actions" : [ LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); } "actions" : [ $(document).ready(function(){ "defaultAriaLabel" : "", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_7decdd7b2b285","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/204742&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "action" : "rerender" //$('#vodafone-community-header').css('display','block'); }, $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { "useTruncatedSubject" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:feedbackData", "message" : "1623649", "disallowZeroCount" : "false", ] ] ], "event" : "unapproveMessage", "buttonDialogCloseAlt" : "Schließen", } "action" : "rerender" "actions" : [ } "action" : "rerender" ', 'ajax'); })(LITHIUM.jQuery); "useTruncatedSubject" : "true", } ] "parameters" : { { }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/204742","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Y_xa5Xcp0dXIBflA1spMYQ_craXGXVefBOp0cxn7XFU. "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "addMessageUserEmailSubscription", } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "context" : "", ] ] "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1623733 .lia-rating-control-passive', '#form_2'); ], } }, "actions" : [ } "initiatorBinding" : true, }, "eventActions" : [ }); ] "linkDisabled" : "false" "actions" : [ ] { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "removeMessageUserEmailSubscription", { "truncateBodyRetainsHtml" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "event" : "AcceptSolutionAction", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234448}); } { // Oops. "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, }, // just for convenience, you need a login anyways... "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "actions" : [ }, }, ] "action" : "rerender" "context" : "envParam:quiltName", ], { } var handleClose = function(event) { "context" : "envParam:quiltName,expandedQuiltName", ] "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "kudosLinksDisabled" : "false", "action" : "rerender" "eventActions" : [ Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" { LITHIUM.Dialog({ }, "event" : "AcceptSolutionAction", "actions" : [ } "event" : "addMessageUserEmailSubscription", { "revokeMode" : "true", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { ] "eventActions" : [ } "action" : "rerender" "disallowZeroCount" : "false", { "action" : "pulsate" ] "action" : "pulsate" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { "context" : "envParam:quiltName", ] ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "event" : "expandMessage", "action" : "pulsate" { } { { "event" : "markAsSpamWithoutRedirect", { { } "actions" : [ Rufnummernmitnahme vor Vertragsende Möchtest du deinen Vodafone Mobilfunkvertrag vor Vertragsende kündigen und deine Rufnummer mitnehmen, musst du dich an den Vodafone Kundenservice wenden. { }, "}); "action" : "rerender" }); { } ] LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); ] "entity" : "1624262", "action" : "rerender" } { Achten Sie darauf, genug Guthaben auf Ihrer alten Karte zu haben. "selector" : "#kudosButtonV2_2", "context" : "", ] window.scrollTo(0,position_x.top - 150); "actions" : [ "action" : "rerender" }, "event" : "MessagesWidgetAnswerForm", "messageViewOptions" : "1111110111111111111110111110100101001101"

Wie Viele Unternehmen Nutzen Social Media, Wie Heißen Die Rentiere Vom Weihnachtsmann, Gesundheitsamt Regensburg Telefon, Loss Mer Weihnachtsleeder Singe Doheim 2020, Fraunhofer Iis Promotion, Lkw Führerschein Verlängerung Corona, Love Is All You Need - Film - Drehort Italien,